Crystal structures of pheasant and guinea fowl egg-white lysozymes

Multiple lysozymes of duck egg white.

Lysozyme was purified from a pooled sample of Peking duck egg whites by ion exchange chromatography and gel filtration. Three different lysozymes were found, and each was shown to be pure by several criteria. The three enzymes were like chicken lysozyme in molecular size and specific activity, although they could be distinguished from it, as well as from one another, by electrophoretic and immu...

Fluorine-19 nuclear magnetic resonance spectroscopic study of fluorophenylalanine- and fluorotryptophan-labeled avian egg white lysozymes.

We report the 470-MHz (11.7 T) 19F solution nuclear magnetic resonance (NMR) spectra of 2-, 3-, and 4-fluorophenylalanine incorporated into the egg white lysozymes (EC 3.2.1.17) of chicken, pheasant, and duck, as well as spectra of 4-fluorotryptophan incorporated into chicken, California valley quail, and Bob White quail and 5- and 6-fluorotryptophan-labeled chicken lysozyme. The 19F solution N...

The amino acid sequence of lysozyme from kalij pheasant (Lophura leucomelana) egg-white.

The amino acid sequence of kalij pheasant lysozyme has been analyzed. From the comparison of the tryptic peptide pattern of kalij pheasant lysozyme and maps from other bird lysozymes followed by the sequencing of tryptic peptides, the amino acid sequence of kalij pheasant was found to be: KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKYESNFNTHATNRNTDGSTDYGIL- QINSRWWCNDGKTPGSRNLCHIPCSALLSSDITASVNCAKKIVSDGNGM...

The Egg Records of Limited Periods as Criteria for Predicting the Egg Production of the White Leghorn Fowl.

Prediction of the production of a group of remaining months from the record of any month.. ................................................................ 2Y1 Prediction of annual production from the sum of two monthly records. ............. 289 Prediction of the production of a group of remaining months from the sum of two monthly records. ........................................................

An Electrophoretic Study of Egg-White Proteins in Twenty-Three Breeds of the Domestic Fowl